Retatrutide 10 mg — wholesale vial for research
Retatrutide is a patented Eli Lilly triple-agonist molecule (LY3437943). Not approved in any jurisdiction as of 2026. Supplied for research and clinical trial supply only — not for commercial distribution in jurisdictions where patent protection is active.
Specifications
| Attribute | Value |
|---|---|
| Molecular formula | C₂₂₁H₃₄₂N₄₈O₆₈ (approximate, based on the published triple-agonist backbone) |
| Sequence | YXQETFPSDLPKQEQESEQDAEKMKPSKAPPPSLVPQPGRG-NH2 (39 amino acid triple agonist; sequence disclosed on the COA and spec sheet) |
| Molecular weight | 4,231.7 g/mol (approximate; lot-specific MW on COA) |
| CAS | 2381089-83-2 |
| Purity | ≥99% HPLC |
| Form | Lyophilized powder |
| Packaging | 10 mg vial · bulk on request |
| Storage | -20°C, protected from light and moisture |
| Regulatory positioning | Retatrutide is a patented Eli Lilly triple-agonist molecule (LY3437943). Not approved in any jurisdiction as of 2026. Supplied for research and clinical trial supply only — not for commercial distribution in jurisdictions where patent protection is active. |
Regulatory positioning: Clinical trial supply only. Retatrutide is a patented Eli Lilly triple-agonist molecule (LY3437943). Not approved in any jurisdiction as of 2026. Supplied for research and clinical trial supply only — not for commercial distribution in jurisdictions where patent protection is active. Subject to buyer compliance with applicable patent law in the destination jurisdiction.
Overview
Retatrutide is a synthetic triple-agonist research peptide that engages three receptor pathways — GIP, GLP-1, and glucagon — in a single molecule. Retatrutide 10 mg is the standard 10 mg research vial format, supplied lyophilized, intended for in-vitro receptor-binding studies, cell-based signalling assays, and analytical method development. SPK Pharma India supplies Retatrutide 10 mg as a documented, lot-traceable research compound for distributors, contract manufacturers, and academic laboratories, with the full triple-agonist sequence disclosed on the lot-matched Certificate of Analysis. The product is supplied for research and analytical applications only.
Specifications
| Parameter | Value |
|---|---|
| Compound name | Retatrutide |
| Compound class | Synthetic triple-agonist peptide (GIP / GLP-1 / glucagon receptor agonist) |
| CAS number | 2381089-83-2 |
| Molecular formula | C₂₂₁H₃₄₂N₄₈O₆₈ (approximate) |
| Molecular weight | 4,231.7 g/mol (approximate; lot-specific MW on COA) |
| Amino acid count | 39 residues |
| Appearance | White to off-white lyophilized powder |
| Purity | ≥99% by HPLC |
| Identity | Confirmed by mass spectrometry and amino acid analysis |
| Form | Lyophilized powder |
| Packaging | 10 mg vial · bulk on request |
| Storage | -20°C, protected from light and moisture |
| Shelf life | 24 months from manufacture date, stored as recommended |
| Intended use | Research use only — not for human or veterinary use |
Research context
Triple-agonist peptides that engage GIP, GLP-1, and glucagon receptors in a single molecule are an active area of metabolic pathway research. In-vitro receptor-binding assays, cell-based cAMP signalling assays, and downstream pathway analysis are the typical research applications, with the triple-agonist mechanism offering a defined research comparator to single-agonist and dual-agonist peptides. Retatrutide is used in research contexts that study how simultaneous engagement of these three receptors affects downstream signalling, gene expression, and cellular metabolism in defined cell-based systems.
The academic literature on multi-receptor agonism in the GIP / GLP-1 / glucagon family has grown significantly over recent years, with research-grade assays established for each of the three receptor pathways and for the heterodimer combinations that may be formed in defined cell lines. SPK Pharma India does not make therapeutic, clinical, diagnostic, or dosing claims for this product. The compound is supplied strictly for in-vitro research, analytical method development, and reference-standard work.
For researchers new to the compound, the standard analytical reference points are CAS 2381089-83-2, the 39-amino-acid backbone, the approximate molecular weight, the lyophilized powder form, and the documented purity threshold (≥99% HPLC). The full amino acid sequence is disclosed on the lot-matched COA and on the product specification sheet, which is available on request to qualifying trade buyers.
Packaging and supply
- 10 mg research vial — the standard 10 mg research format, suitable for method development, receptor-binding assays, and reference-standard qualification. Standard MOQ: 5 vials.
- Bulk pack — on application, for annual supply contracts and recurring orders across the 10 mg / 20 mg / 30 mg / 40 mg tiered formats.
Distributor pricing is available on application, with volume tiers structured across the 10/20/30/40 mg formats. Annual supply contracts with scheduled recurring dispatch are available for repeat buyers. Lead time for in-stock SKUs is typically 5 business days from purchase order confirmation; lead time for scheduled production is typically 4 to 6 weeks.
Quality and documentation
Every lot of Retatrutide 10 mg ships with a lot-matched Certificate of Analysis documenting identity (mass spectrometry and amino acid analysis), purity (HPLC), appearance, lot number, and synthesis batch reference. A representative sample of every lot is independently verified by a third-party analytical laboratory before release. MSDS is supplied with every shipment. The COA template, the lot-traceability workflow, and the third-party verification scope are documented on the Quality page.
Storage and handling
- Store at -20°C in the original sealed container.
- Protect from light and moisture.
- Allow the sealed container to reach room temperature before opening, to avoid condensation.
- Reconstitute in sterile, low-endotoxin research-grade water or in a mild buffer at the working concentration required by the assay.
- Do not refreeze once reconstituted; aliquot and store at working concentration.
- For longer peptides, avoid vigorous vortexing; allow gentle dissolution to minimise aggregation.
Shipping
Retatrutide 10 mg is shipped lyophilized in sealed vials within temperature-validated packaging. International lanes are routed through dedicated life-science logistics partners with cold-chain handling. Standard dispatch is within 5 business days of purchase order confirmation. SPK Pharma India ships to the United States, the European Union, the United Kingdom, Canada, MENA, APAC, and LATAM. Full export documentation, including commercial invoice, packing list, certificate of origin, COA, and MSDS, is included with every shipment. Destination-specific documentation is supported on request.
Compliance
Retatrutide is a patented Eli Lilly triple-agonist molecule (LY3437943). Not approved in any jurisdiction as of 2026. Supplied for research and clinical trial supply only — not for commercial distribution in jurisdictions where patent protection is active. SPK Pharma India does not make therapeutic, clinical, diagnostic, or dosing claims for this product. The buyer is responsible for end-use classification in the destination jurisdiction, for compliance with applicable patent law, and for ensuring that downstream handling is consistent with the regulatory positioning stated above.
Lead form CTA
To request a wholesale quote for Retatrutide 10 mg, contact the trade desk with the subject line "Retatrutide 10 mg wholesale quote" and your company details, expected volume, and destination country. Distributor pricing is available on application. The desk responds within one business day.
Related compounds
- Retatrutide 20 mg — concentrated research vial format
- Retatrutide 30 mg — bulk research vial format
- Retatrutide 40 mg — highest-strength research vial format
- Cagrilintide — long-chain amylin analogue research peptide
- 5-Amino-1MQ — small-molecule NNMT inhibitor scaffold
Request a quote for Retatrutide 10 mg
Quote requests answered within one business day. Volume pricing for recurring orders.