CJC-1295 without DAC (Modified GRF 1-29) — wholesale supply
For research and laboratory use only. Not approved as a drug, medical device, or diagnostic agent in any jurisdiction. Not for human or veterinary use.
Specifications
| Attribute | Value |
|---|---|
| Molecular formula | C₁₅₂H₂₅₂N₄₄O₄₂ |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (29 amino acids, amidated C-terminus; Modified GRF 1-29) |
| Molecular weight | 3,367.9 g/mol |
| CAS | 863288-34-8 |
| Purity | ≥99% HPLC |
| Form | Lyophilized powder |
| Packaging | 2 mg · 5 mg · bulk on request |
| Storage | -20°C, protected from light and moisture |
| Regulatory positioning | For research and laboratory use only. Not approved as a drug, medical device, or diagnostic agent in any jurisdiction. Not for human or veterinary use. |
For research use only · Not for human consumption · Not for veterinary use. This product is supplied for in-vitro research, analytical method development, and laboratory reference standard use only. Not approved for human or veterinary administration. Buyer is responsible for end-use classification in the destination jurisdiction.
Overview
CJC-1295 without DAC, also referenced as Modified GRF 1-29, Mod GRF 1-29, or CJC no DAC, is a 29-amino-acid synthetic analogue of growth hormone-releasing hormone (GHRH) that lacks the drug-affinity complex (DAC) modification present in the longer-acting CJC-1295 DAC variant. The compound is supplied as a research-grade lyophilized peptide, intended for in-vitro GHRH receptor research, growth hormone axis pathway studies, and analytical method development. SPK Pharma India supplies CJC no DAC as a documented, lot-traceable research compound for distributors, contract manufacturers, and academic laboratories. The disambiguation from CJC-1295 with DAC is important for research buyers — the two compounds have different pharmacokinetic profiles, different analytical characteristics, and different receptor-research applications.
Specifications
| Parameter | Value |
|---|---|
| Compound name | CJC-1295 without DAC (Modified GRF 1-29) |
| Synonyms | CJC no DAC, Mod GRF 1-29, Modified Growth Hormone-Releasing Factor 1-29 |
| Compound class | Synthetic GHRH analogue |
| CAS number | 863288-34-8 |
| Molecular formula | C₁₅₂H₂₅₂N₄₄O₄₂ |
| Molecular weight | 3,367.9 g/mol |
| Amino acid count | 29 residues |
| C-terminus | Amidated (-NH₂) |
| Appearance | White to off-white lyophilized powder |
| Purity | ≥99% by HPLC |
| Identity | Confirmed by mass spectrometry and amino acid analysis |
| Form | Lyophilized powder |
| Packaging | 2 mg vial · 5 mg vial · bulk on request |
| Storage | -20°C, protected from light and moisture |
| Shelf life | 24 months from manufacture date, stored as recommended |
| Intended use | Research use only — not for human or veterinary use |
Research context
CJC-1295 without DAC is a well-characterised research tool in the growth hormone axis. The GHRH receptor (GHRHR) is a Class B G-protein-coupled receptor expressed in the anterior pituitary, and receptor-binding, cAMP signalling, and downstream pathway analysis are the typical in-vitro research applications. The "without DAC" form, with its shorter plasma half-life relative to the DAC-modified form, is used in research contexts where the unmodified GHRH-receptor engagement profile is the variable of interest.
The Modified GRF 1-29 backbone includes four amino acid substitutions relative to native GHRH 1-29, which confer resistance to enzymatic degradation and improve the in-vitro stability profile. The full sequence is disclosed on the lot-matched COA and the product specification sheet. The compound is also used as a research comparator in studies that investigate GHRH-receptor agonists, growth hormone secretagogue receptor (GHSR) agonists, and the interaction of the GHRH and ghrelin pathways in defined cell-based systems. SPK Pharma India does not make therapeutic, clinical, diagnostic, or dosing claims for this product.
For researchers new to the compound, the standard analytical reference points are CAS 863288-34-8, the 29-amino-acid sequence, the amidated C-terminus, the calculated molecular weight of 3,367.9 g/mol, the lyophilized powder form, and the documented purity threshold (≥99% HPLC).
Packaging and supply
- 2 mg research vial — for method development, receptor-binding assays, and reference-standard qualification. Standard MOQ: 5 vials.
- 5 mg research vial — for ongoing research programmes with higher per-assay demand. Standard MOQ: 2 vials.
- Bulk pack — on application, for annual supply contracts and recurring orders.
Distributor pricing is available on application. Annual supply contracts with scheduled recurring dispatch are available for repeat buyers. Lead time for in-stock SKUs is typically 5 business days from purchase order confirmation; lead time for scheduled production is typically 4 to 6 weeks.
Quality and documentation
Every lot of CJC no DAC ships with a lot-matched Certificate of Analysis documenting identity (mass spectrometry and amino acid analysis), purity (HPLC), appearance, lot number, and synthesis batch reference. A representative sample of every lot is independently verified by a third-party analytical laboratory before release. MSDS is supplied with every shipment. The COA template, the lot-traceability workflow, and the third-party verification scope are documented on the Quality page.
Storage and handling
- Store at -20°C in the original sealed container.
- Protect from light and moisture.
- Allow the sealed container to reach room temperature before opening, to avoid condensation.
- Reconstitute in sterile, low-endotoxin research-grade water or in a mild buffer at the working concentration required by the assay.
- Do not refreeze once reconstituted; aliquot and store at working concentration.
- Avoid vigorous vortexing; allow gentle dissolution to minimise aggregation.
Shipping
CJC no DAC is shipped lyophilized in sealed vials within temperature-validated packaging. International lanes are routed through dedicated life-science logistics partners with cold-chain handling. Standard dispatch is within 5 business days of purchase order confirmation. SPK Pharma India ships to the United States, the European Union, the United Kingdom, Canada, MENA, APAC, and LATAM. Full export documentation, including commercial invoice, packing list, certificate of origin, COA, and MSDS, is included with every shipment. Destination-specific documentation is supported on request.
Compliance
This product is supplied for research use only. It is not a drug, not a finished dosage form, and not approved for human or veterinary administration. SPK Pharma India does not make therapeutic, clinical, diagnostic, or dosing claims for this product. The buyer is responsible for end-use classification in the destination jurisdiction and for ensuring that downstream handling is consistent with research-use-only protocols.
Lead form CTA
To request a wholesale quote for CJC-1295 without DAC (Modified GRF 1-29), contact the trade desk with the subject line "CJC no DAC wholesale quote" and your company details, expected volume, and destination country. Distributor pricing is available on application. The desk responds within one business day.
Related compounds
- Ipamorelin — selective GHS pentapeptide research peptide
- Tesamorelin — 44-amino-acid GHRH analogue research peptide
- HGH (Somatropin) — 191-amino-acid recombinant research lyophilizate
- IGF-1 LR3 — 83-amino-acid long arginine IGF-1 research peptide
- FOXO4-DRI — 46-amino-acid D-retro-inverso research peptide
Request a quote for CJC-1295 Without DAC (Modified GRF 1-29)
Quote requests answered within one business day. Volume pricing for recurring orders.